PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013618654.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 258aa    MW: 28877.2 Da    PI: 7.1623
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013618654.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding32.32.3e-102470447
                     S-HHHHHHHHHHHHHTTTT....-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  4 WTteEdellvdavkqlGgg....tWktIartmgkgRtlkqcksrwqky 47
                     WT eE +++ +a + lG +    +W+ Ia+ ++ g++  +++ r+ k+
   XP_013618654.1 24 WTVEENKRFEKALAVLGDKddleSWSNIAALIP-GKSVDDVIKRYKKL 70
                     *********************************.***********996 PP

2Myb_DNA-binding507e-16138182347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ +++ + k++G+g+W+ Iar + ++Rt+ q+ s+ qky
   XP_013618654.1 138 PWTEEEHRRFLMGLKKYGKGDWRNIARNFVTTRTPTQVASHAQKY 182
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.3E-51270IPR009057Homeodomain-like
SuperFamilySSF466895.76E-91376IPR009057Homeodomain-like
PROSITE profilePS512937.8051973IPR017884SANT domain
SMARTSM007172.5E-52073IPR001005SANT/Myb domain
CDDcd001671.94E-82470No hitNo description
PfamPF002497.9E-92470IPR001005SANT/Myb domain
PROSITE profilePS5129422.32131187IPR017930Myb domain
SuperFamilySSF466891.52E-17133186IPR009057Homeodomain-like
TIGRFAMsTIGR015571.9E-18134186IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.602.1E-13135182IPR009057Homeodomain-like
SMARTSM007171.9E-13135185IPR001005SANT/Myb domain
PfamPF002495.0E-13138182IPR001005SANT/Myb domain
CDDcd001671.52E-11138183No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 258 aa     Download sequence    Send to blast
MSSTNGGYQE NTNWIFQEVK DAMWTVEENK RFEKALAVLG DKDDLESWSN IAALIPGKSV  60
DDVIKRYKKL EDDISDIEAG LVPDPGYCSD ASAGDYFFGL ENSGYGYNYV VGGKRSSPAT  120
TDGFRLPMPE KERKKGVPWT EEEHRRFLMG LKKYGKGDWR NIARNFVTTR TPTQVASHAQ  180
KYFIRQLTDG KDKRRSSIHD ITTVNVPDAN APTTATPAAA TVSPTPTNPF DVFLPPKPHH  240
SFAFSPASSY HNTFPQWS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013618654.10.0PREDICTED: transcription factor DIVARICATA
SwissprotQ8S9H79e-75DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A0D3AHE80.0A0A0D3AHE8_BRAOL; Uncharacterized protein
STRINGBra028892.1-P1e-161(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM148841619
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G01200.11e-119MYB family protein